PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S03616.20
Common NameJCGZ_24861, LOC105631543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MYB_related
Protein Properties Length: 377aa    MW: 40935.4 Da    PI: 6.9502
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S03616.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.4e-13115159347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ Iar     R++ q+ s+ qky
    Jcr4S03616.20 115 PWTEEEHRLFLVGLQKLGKGDWRGIARNYVVSRSPTQVASHAQKY 159
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.109.2E-4322IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.762108164IPR017930Myb domain
SuperFamilySSF466892.92E-16110165IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-18111163IPR006447Myb domain, plants
SMARTSM007178.1E-11112162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-10112158IPR009057Homeodomain-like
CDDcd001671.59E-9115160No hitNo description
PfamPF002493.3E-11115159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RSSGASSSSA SSLSGVRLFG VRLTDGSIIK KSASMSNLSA  60
HYHSSSSAAA SPNPDSPLSD HVRDSGNVPE GYLSDDPAHA SCSTNRRGER KKGVPWTEEE  120
HRLFLVGLQK LGKGDWRGIA RNYVVSRSPT QVASHAQKYF IRQSNATRRK RRSSLFDMVP  180
DMASEPQPVP EEQESVSCQV GETDNANSLP SLNLSLKPEY EPMETTSEEP AKESDETATG  240
SSEFRQTVSS SSEFTPIVPQ LNEFPQFVPG FYPAYMPIPY PCWPPNTATL EEVKSVETSG  300
HKVLKPVPIF AKEPVNVDEL VGMSHLSIGE TERGHREPSP LSLKLIGEPS RQSAFHANAP  360
VSGSELSQGK ASPIQAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4293563e-74AB429356.1 Bruguiera gymnorhiza mRNA for myb transcription factor, complete cds, clone: Bg01-04_N14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069084.10.0PREDICTED: myb-like protein H
TrEMBLA0A067KXJ70.0A0A067KXJ7_JATCU; Uncharacterized protein
STRINGGLYMA13G43120.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.18e-96MYB_related family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]